Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1535636..1536285 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | MR177_RS07240 | Protein ID | WP_003403236.1 |
Coordinates | 1535636..1536031 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | MR177_RS07245 | Protein ID | WP_003403235.1 |
Coordinates | 1536031..1536285 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS07215 | 1530963..1532690 | + | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
MR177_RS07220 | 1532783..1533934 | + | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
MR177_RS07225 | 1534006..1534413 | - | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
MR177_RS07230 | 1534410..1534670 | - | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR177_RS07235 | 1534802..1535542 | + | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
MR177_RS07240 | 1535636..1536031 | - | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
MR177_RS07245 | 1536031..1536285 | - | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
MR177_RS07250 | 1536378..1537325 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
MR177_RS07255 | 1537336..1538493 | - | 1158 | WP_003903091.1 | hypothetical protein | - |
MR177_RS07260 | 1538888..1539979 | - | 1092 | WP_003900977.1 | galactokinase | - |
MR177_RS07265 | 1539976..1541058 | - | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
MR177_RS07270 | 1541077..1541160 | - | 84 | Protein_1432 | galactose-1-phosphate uridylyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T295286 WP_003403236.1 NZ_OW052570:c1536031-1535636 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC2 |