Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1498545..1499178 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQD6 |
| Locus tag | MR177_RS07055 | Protein ID | WP_003403365.1 |
| Coordinates | 1498795..1499178 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ56 |
| Locus tag | MR177_RS07050 | Protein ID | WP_003403368.1 |
| Coordinates | 1498545..1498700 (+) | Length | 52 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS07020 | 1493662..1496025 | - | 2364 | WP_031657581.1 | arylsulfatase AtsD | - |
| MR177_RS07025 | 1496139..1496393 | + | 255 | WP_003911263.1 | antitoxin VapB7 | - |
| MR177_RS07030 | 1496390..1496827 | + | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR177_RS07035 | 1496937..1497182 | + | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
| MR177_RS07040 | 1497169..1497477 | + | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MR177_RS07045 | 1497753..1498469 | + | 717 | WP_003903122.1 | CPBP family intramembrane metalloprotease | - |
| MR177_RS07050 | 1498545..1498700 | + | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MR177_RS07055 | 1498795..1499178 | + | 384 | WP_003403365.1 | ribonuclease VapC6 | Toxin |
| MR177_RS07060 | 1499566..1500576 | - | 1011 | WP_031653722.1 | ABC transporter ATP-binding protein | - |
| MR177_RS07065 | 1500657..1502162 | - | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
| MR177_RS07070 | 1502233..1502928 | + | 696 | WP_003403355.1 | TetR/AcrR family transcriptional regulator | - |
| MR177_RS07075 | 1502921..1503313 | - | 393 | WP_003403353.1 | 50S ribosomal protein L7/L12 | - |
| MR177_RS07080 | 1503350..1503886 | - | 537 | WP_003403341.1 | 50S ribosomal protein L10 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13959.73 Da Isoelectric Point: 6.0803
>T295284 WP_003403365.1 NZ_OW052570:1498795-1499178 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSF8 |