Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1496139..1496827 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB2 |
Locus tag | MR177_RS07030 | Protein ID | WP_003403386.1 |
Coordinates | 1496390..1496827 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O06777 |
Locus tag | MR177_RS07025 | Protein ID | WP_003911263.1 |
Coordinates | 1496139..1496393 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS07005 | 1492853..1493026 | - | 174 | WP_003898549.1 | hypothetical protein | - |
MR177_RS07010 | 1493023..1493361 | - | 339 | WP_003403405.1 | PIN domain-containing protein | - |
MR177_RS07015 | 1493273..1493599 | - | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR177_RS07020 | 1493662..1496025 | - | 2364 | WP_031657581.1 | arylsulfatase AtsD | - |
MR177_RS07025 | 1496139..1496393 | + | 255 | WP_003911263.1 | antitoxin VapB7 | Antitoxin |
MR177_RS07030 | 1496390..1496827 | + | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR177_RS07035 | 1496937..1497182 | + | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
MR177_RS07040 | 1497169..1497477 | + | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
MR177_RS07045 | 1497753..1498469 | + | 717 | WP_003903122.1 | CPBP family intramembrane metalloprotease | - |
MR177_RS07050 | 1498545..1498700 | + | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MR177_RS07055 | 1498795..1499178 | + | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
MR177_RS07060 | 1499566..1500576 | - | 1011 | WP_031653722.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T295281 WP_003403386.1 NZ_OW052570:1496390-1496827 [Mycobacterium tuberculosis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSW5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806JQG1 |