Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
| Location | 1237686..1238305 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | novel[antitoxin] | Uniprot ID | - |
| Locus tag | MR177_RS05720 | Protein ID | WP_003404726.1 |
| Coordinates | 1237686..1238120 (-) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | novel[toxin] | Uniprot ID | G0TFQ5 |
| Locus tag | MR177_RS05725 | Protein ID | WP_003404724.1 |
| Coordinates | 1238126..1238305 (-) | Length | 60 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS05695 | 1233021..1234259 | + | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
| MR177_RS05700 | 1234261..1235769 | + | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
| MR177_RS05705 | 1235936..1236166 | + | 231 | WP_003898642.1 | hypothetical protein | - |
| MR177_RS05710 | 1236301..1236750 | - | 450 | WP_003404738.1 | hypothetical protein | - |
| MR177_RS05715 | 1236815..1237588 | - | 774 | WP_003404735.1 | VOC family protein | - |
| MR177_RS05720 | 1237686..1238120 | - | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
| MR177_RS05725 | 1238126..1238305 | - | 180 | WP_003404724.1 | antitoxin | Antitoxin |
| MR177_RS05730 | 1238431..1238589 | - | 159 | WP_003404720.1 | hypothetical protein | - |
| MR177_RS05735 | 1238862..1241255 | - | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
| MR177_RS05740 | 1241252..1242832 | - | 1581 | WP_003909313.1 | serine hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T295279 WP_003404726.1 NZ_OW052570:c1238120-1237686 [Mycobacterium tuberculosis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|