Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1024124..1024755 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
| Locus tag | MR177_RS04670 | Protein ID | WP_003405820.1 |
| Coordinates | 1024444..1024755 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TGZ7 |
| Locus tag | MR177_RS04665 | Protein ID | WP_003405836.1 |
| Coordinates | 1024124..1024444 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS04640 | 1019320..1019958 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
| MR177_RS04645 | 1019955..1021202 | + | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
| MR177_RS04650 | 1021192..1021449 | + | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
| MR177_RS04655 | 1021459..1022571 | + | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
| MR177_RS04660 | 1022578..1024114 | - | 1537 | Protein_922 | carboxylesterase/lipase family protein | - |
| MR177_RS04665 | 1024124..1024444 | + | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
| MR177_RS04670 | 1024444..1024755 | + | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
| MR177_RS04675 | 1024867..1026024 | + | 1158 | WP_003898727.1 | AI-2E family transporter | - |
| MR177_RS04680 | 1026031..1026675 | - | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
| MR177_RS04685 | 1026731..1027819 | + | 1089 | WP_017351234.1 | class II fructose-bisphosphatase | - |
| MR177_RS04690 | 1027850..1029274 | + | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T295276 WP_003405820.1 NZ_OW052570:1024444-1024755 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4F9D0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TGZ7 |