Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 1015431..1015999 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TH08 |
Locus tag | MR177_RS04615 | Protein ID | WP_003405865.1 |
Coordinates | 1015431..1015805 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TH07 |
Locus tag | MR177_RS04620 | Protein ID | WP_003405863.1 |
Coordinates | 1015802..1015999 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS04580 | 1011781..1012551 | + | 771 | Protein_906 | adenylate/guanylate cyclase domain-containing protein | - |
MR177_RS04585 | 1012503..1012712 | - | 210 | WP_003911400.1 | hypothetical protein | - |
MR177_RS04590 | 1012746..1013444 | + | 699 | WP_031646953.1 | hypothetical protein | - |
MR177_RS04595 | 1013459..1013782 | - | 324 | WP_003405871.1 | putative quinol monooxygenase | - |
MR177_RS04600 | 1014025..1014300 | + | 276 | WP_003405867.1 | hypothetical protein | - |
MR177_RS04605 | 1014227..1014412 | - | 186 | WP_003901093.1 | hypothetical protein | - |
MR177_RS04610 | 1014530..1015228 | - | 699 | WP_003898733.1 | hypothetical protein | - |
MR177_RS04615 | 1015431..1015805 | - | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR177_RS04620 | 1015802..1015999 | - | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR177_RS04625 | 1016087..1017160 | - | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
MR177_RS04630 | 1017223..1018206 | + | 984 | WP_003903326.1 | hypothetical protein | - |
MR177_RS04635 | 1018223..1019230 | - | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
MR177_RS04640 | 1019320..1019958 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T295275 WP_003405865.1 NZ_OW052570:c1015805-1015431 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|