Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PhRel-ATphRel/- |
Location | 715944..716994 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | phRel | Uniprot ID | G0TIH2 |
Locus tag | MR177_RS03275 | Protein ID | WP_003407164.1 |
Coordinates | 716173..716994 (-) | Length | 274 a.a. |
Antitoxin (Protein)
Gene name | ATphRel | Uniprot ID | - |
Locus tag | MR177_RS03270 | Protein ID | WP_242302848.1 |
Coordinates | 715944..716171 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS03255 | 711914..713383 | - | 1470 | WP_003900326.1 | cytochrome b5 domain-containing protein | - |
MR177_RS03260 | 713579..714364 | - | 786 | WP_003407180.1 | lipoprotein LprF | - |
MR177_RS03265 | 714667..715872 | + | 1206 | WP_003918234.1 | serine hydrolase domain-containing protein | - |
MR177_RS03270 | 715944..716171 | - | 228 | WP_242302848.1 | hypothetical protein | Antitoxin |
MR177_RS03275 | 716173..716994 | - | 822 | WP_003407164.1 | GTP pyrophosphokinase family protein | Toxin |
MR177_RS03280 | 717215..717601 | + | 387 | WP_003904611.1 | anti-sigma-F factor antagonist RsfA | - |
MR177_RS03285 | 717740..719701 | + | 1962 | WP_003407159.1 | sigma-F factor regulator | - |
MR177_RS03290 | 719992..720777 | + | 786 | WP_003407157.1 | membrane protein | - |
MR177_RS03295 | 720774..721436 | + | 663 | WP_003407152.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 274 a.a. Molecular weight: 30100.10 Da Isoelectric Point: 5.8187
>T295272 WP_003407164.1 NZ_OW052570:c716994-716173 [Mycobacterium tuberculosis]
VVVALVGSAIVDLHSRPPWSNNAVRRLGVALRDGVDPPVDCPSYAEVMLWHADLAAEVQDRIEGRSWSASELLVTSRAKS
QDTLLAKLRRRPYLQLNTIQDIAGVRIDADLLLGEQTRLAREIADHFGADQPAIHDLRDHPHAGYRAVHVWLRLPAGRVE
IQIRTILQSLWANFYELLADAYGRGIRYDERPEQLAAGVVPAQLQELVGVMQDASADLAMHEAEWQHCAEIEYPGQRAMA
LGEASKNKATVLATTKFRLERAINEAESAGGGG
VVVALVGSAIVDLHSRPPWSNNAVRRLGVALRDGVDPPVDCPSYAEVMLWHADLAAEVQDRIEGRSWSASELLVTSRAKS
QDTLLAKLRRRPYLQLNTIQDIAGVRIDADLLLGEQTRLAREIADHFGADQPAIHDLRDHPHAGYRAVHVWLRLPAGRVE
IQIRTILQSLWANFYELLADAYGRGIRYDERPEQLAAGVVPAQLQELVGVMQDASADLAMHEAEWQHCAEIEYPGQRAMA
LGEASKNKATVLATTKFRLERAINEAESAGGGG
Download Length: 822 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|