Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 681975..682630 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A7U4FAR1 |
Locus tag | MR177_RS03125 | Protein ID | WP_003407268.1 |
Coordinates | 682229..682630 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TIK2 |
Locus tag | MR177_RS03120 | Protein ID | WP_003407272.1 |
Coordinates | 681975..682232 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS03100 | 677162..679129 | - | 1968 | WP_003407285.1 | primosomal protein N' | - |
MR177_RS03105 | 679210..679947 | - | 738 | WP_031647000.1 | lysoplasmalogenase | - |
MR177_RS03110 | 679946..680908 | + | 963 | WP_003407279.1 | alpha/beta hydrolase | - |
MR177_RS03115 | 680933..681892 | + | 960 | WP_015631299.1 | alpha/beta hydrolase | - |
MR177_RS03120 | 681975..682232 | + | 258 | WP_003407272.1 | CopG family transcriptional regulator | Antitoxin |
MR177_RS03125 | 682229..682630 | + | 402 | WP_003407268.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR177_RS03130 | 682885..684615 | + | 1731 | WP_031653809.1 | PE family protein | - |
MR177_RS03135 | 684661..685695 | - | 1035 | WP_003407264.1 | AraC family transcriptional regulator | - |
MR177_RS03140 | 685773..687158 | + | 1386 | WP_003407260.1 | cytochrome P450 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14894.39 Da Isoelectric Point: 11.6897
>T295271 WP_003407268.1 NZ_OW052570:682229-682630 [Mycobacterium tuberculosis]
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAR1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TIK2 |