Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 569403..570019 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | MR177_RS02625 | Protein ID | WP_003407593.1 |
Coordinates | 569403..569720 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | MR177_RS02630 | Protein ID | WP_003900349.1 |
Coordinates | 569717..570019 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS02595 | 564412..565440 | - | 1029 | Protein_515 | glycosyltransferase family 2 protein | - |
MR177_RS02600 | 565485..565883 | - | 399 | WP_003900351.1 | hypothetical protein | - |
MR177_RS02605 | 565944..566156 | + | 213 | WP_003898900.1 | dodecin family protein | - |
MR177_RS02610 | 566370..566987 | + | 618 | WP_003407606.1 | class I SAM-dependent methyltransferase | - |
MR177_RS02615 | 567060..568349 | - | 1290 | WP_003407599.1 | serine hydrolase domain-containing protein | - |
MR177_RS02620 | 568402..569406 | - | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
MR177_RS02625 | 569403..569720 | - | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
MR177_RS02630 | 569717..570019 | - | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
MR177_RS02635 | 570033..572285 | - | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
MR177_RS02640 | 572286..574133 | - | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T295270 WP_003407593.1 NZ_OW052570:c569720-569403 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|