Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 491048..491661 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64880 |
Locus tag | MR177_RS02280 | Protein ID | WP_003407786.1 |
Coordinates | 491048..491452 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
Locus tag | MR177_RS02285 | Protein ID | WP_009935474.1 |
Coordinates | 491458..491661 (-) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS02270 | 487001..489298 | + | 2298 | WP_003407790.1 | malto-oligosyltrehalose synthase | - |
MR177_RS02275 | 489291..491031 | + | 1741 | Protein_451 | malto-oligosyltrehalose trehalohydrolase | - |
MR177_RS02280 | 491048..491452 | - | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
MR177_RS02285 | 491458..491661 | - | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR177_RS02290 | 491714..493003 | - | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
MR177_RS02295 | 493038..493484 | - | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
MR177_RS02300 | 493494..496397 | - | 2904 | WP_003904644.1 | MMPL family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T295269 WP_003407786.1 NZ_OW052570:c491452-491048 [Mycobacterium tuberculosis]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|