Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 317836..318449 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFA2 |
| Locus tag | MR177_RS01530 | Protein ID | WP_003408465.1 |
| Coordinates | 318060..318449 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ52 |
| Locus tag | MR177_RS01525 | Protein ID | WP_003408469.1 |
| Coordinates | 317836..318063 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS01505 | 313728..314438 | + | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
| MR177_RS01510 | 314428..314847 | + | 420 | WP_003408483.1 | hypothetical protein | - |
| MR177_RS01515 | 314890..316137 | - | 1248 | WP_003408476.1 | serine hydrolase | - |
| MR177_RS01520 | 316134..317618 | - | 1485 | WP_003904684.1 | biotin carboxylase | - |
| MR177_RS01525 | 317836..318063 | + | 228 | WP_003408469.1 | antitoxin | Antitoxin |
| MR177_RS01530 | 318060..318449 | + | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR177_RS01535 | 318497..318628 | - | 132 | Protein_305 | IS3 family transposase | - |
| MR177_RS01545 | 319059..319838 | - | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
| MR177_RS01550 | 319852..320670 | - | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
| MR177_RS01555 | 320723..321073 | - | 351 | WP_003898986.1 | cupin domain-containing protein | - |
| MR177_RS01560 | 321073..321903 | - | 831 | Protein_309 | cyclase family protein | - |
| MR177_RS01565 | 321906..322820 | - | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T295268 WP_003408465.1 NZ_OW052570:318060-318449 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BUI9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7E4J | |
| AlphaFold DB | A0A7U4FAN9 |