295264

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 53179..53723 Replicon chromosome
Accession NZ_OW052570
Organism Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag MR177_RS00305 Protein ID WP_003409896.1
Coordinates 53427..53723 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag MR177_RS00300 Protein ID WP_003409899.1
Coordinates 53179..53430 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR177_RS00275 48906..49703 - 798 WP_003899101.1 ABC transporter permease -
MR177_RS00280 50602..51822 + 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
MR177_RS00285 51855..52127 + 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
MR177_RS00290 52131..52538 + 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
MR177_RS00295 52698..53192 - 495 WP_003899099.1 hypothetical protein -
MR177_RS00300 53179..53430 + 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
MR177_RS00305 53427..53723 + 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MR177_RS00310 53772..54386 + 615 WP_003901296.1 hypothetical protein -
MR177_RS00315 54275..54820 - 546 WP_003409891.1 SecB-like chaperone -
MR177_RS00320 54817..55266 - 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
MR177_RS00325 55308..55685 - 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
MR177_RS00330 55660..56181 + 522 WP_003904745.1 hypothetical protein -
MR177_RS00335 56155..56466 - 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
MR177_RS00340 56463..56678 - 216 WP_003409878.1 antitoxin -
MR177_RS00345 56918..57214 + 297 WP_003409877.1 hypothetical protein -
MR177_RS00350 57215..57406 + 192 WP_003409876.1 hypothetical protein -
MR177_RS00355 57427..58329 + 903 WP_003409874.1 hypothetical protein -
MR177_RS00360 58340..58690 + 351 WP_003409871.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T295264 WP_003409896.1 NZ_OW052570:53427-53723 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT295264 WP_003409899.1 NZ_OW052570:53179-53430 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References