Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 26807..27495 | Replicon | chromosome |
Accession | NZ_OW052570 | ||
Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | MR177_RS00155 | Protein ID | WP_003409958.1 |
Coordinates | 27076..27495 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | MR177_RS00150 | Protein ID | WP_003409968.1 |
Coordinates | 26807..27067 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR177_RS00125 | 22298..22897 | - | 600 | WP_003409989.1 | L-lysine exporter | - |
MR177_RS00130 | 23006..23917 | + | 912 | WP_242302831.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
MR177_RS00135 | 24002..24232 | - | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
MR177_RS00140 | 24347..25000 | + | 654 | WP_003409976.1 | cutinase Cfp21 | - |
MR177_RS00145 | 24988..26664 | - | 1677 | WP_003904753.1 | PecA family PE domain-processing aspartic protease | - |
MR177_RS00150 | 26807..27067 | + | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR177_RS00155 | 27076..27495 | + | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR177_RS00160 | 27720..28688 | + | 969 | WP_003899116.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
MR177_RS00165 | 28879..29565 | + | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
MR177_RS00170 | 29744..31189 | + | 1446 | WP_003409946.1 | APC family permease | - |
MR177_RS00175 | 31152..32000 | - | 849 | WP_003409942.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T295263 WP_003409958.1 NZ_OW052570:27076-27495 [Mycobacterium tuberculosis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |