Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 18017..18603 | Replicon | chromosome |
| Accession | NZ_OW052570 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 1.1.2 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLY3 |
| Locus tag | MR177_RS00090 | Protein ID | WP_003410010.1 |
| Coordinates | 18259..18603 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL58 |
| Locus tag | MR177_RS00085 | Protein ID | WP_003410014.1 |
| Coordinates | 18017..18265 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR177_RS00065 | 14000..14767 | - | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
| MR177_RS00070 | 14924..15280 | + | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
| MR177_RS00075 | 15333..15605 | + | 273 | WP_003903706.1 | DUF1490 family protein | - |
| MR177_RS00080 | 15602..17917 | + | 2316 | WP_242302830.1 | cation transporter ATPase CptG | - |
| MR177_RS00085 | 18017..18265 | + | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| MR177_RS00090 | 18259..18603 | + | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
| MR177_RS00095 | 18692..19027 | + | 336 | WP_003410009.1 | dehydrogenase | - |
| MR177_RS00100 | 18928..19185 | - | 258 | WP_003410006.1 | hypothetical protein | - |
| MR177_RS00105 | 19271..19612 | + | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
| MR177_RS00110 | 19609..20169 | + | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
| MR177_RS00115 | 20689..21228 | - | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
| MR177_RS00120 | 21454..21882 | - | 429 | WP_003409992.1 | cellulose-binding protein | - |
| MR177_RS00125 | 22298..22897 | - | 600 | WP_003409989.1 | L-lysine exporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T295261 WP_003410010.1 NZ_OW052570:18259-18603 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|