Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 4421128..4421764 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P0CL62 |
Locus tag | MR176_RS20650 | Protein ID | WP_003410654.1 |
Coordinates | 4421128..4421538 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P9WJ84 |
Locus tag | MR176_RS20655 | Protein ID | WP_003410651.1 |
Coordinates | 4421531..4421764 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS20630 | 4416727..4417950 | + | 1224 | WP_015630218.1 | class I SAM-dependent methyltransferase | - |
MR176_RS20635 | 4417896..4419422 | - | 1527 | WP_003410659.1 | precorrin-2 C(20)-methyltransferase | - |
MR176_RS20640 | 4419419..4420043 | - | 625 | Protein_4079 | precorrin-8X methylmutase | - |
MR176_RS20645 | 4420053..4421144 | - | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
MR176_RS20650 | 4421128..4421538 | - | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
MR176_RS20655 | 4421531..4421764 | - | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
MR176_RS20660 | 4421842..4425426 | + | 3585 | WP_031651157.1 | cobaltochelatase subunit CobN | - |
MR176_RS20665 | 4425510..4425914 | + | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
MR176_RS20670 | 4425915..4426307 | - | 393 | WP_229303073.1 | metal ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T295260 WP_003410654.1 NZ_OW052302:c4421538-4421128 [Mycobacterium tuberculosis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|