Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 4375079..4375774 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O53501 |
| Locus tag | MR176_RS20445 | Protein ID | WP_003410811.1 |
| Coordinates | 4375340..4375774 (+) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TMN0 |
| Locus tag | MR176_RS20440 | Protein ID | WP_003410814.1 |
| Coordinates | 4375079..4375333 (+) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS20410 | 4370429..4370623 | + | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
| MR176_RS20415 | 4370620..4371495 | + | 876 | WP_003411023.1 | proteasome subunit beta | - |
| MR176_RS20420 | 4371492..4372238 | + | 747 | WP_003901330.1 | proteasome subunit alpha | - |
| MR176_RS20425 | 4372777..4373508 | - | 732 | WP_003900467.1 | PPE family protein | - |
| MR176_RS20430 | 4373564..4373860 | - | 297 | WP_003410820.1 | PE family protein | - |
| MR176_RS20435 | 4374806..4375063 | + | 258 | WP_003410816.1 | hypothetical protein | - |
| MR176_RS20440 | 4375079..4375333 | + | 255 | WP_003410814.1 | antitoxin | Antitoxin |
| MR176_RS20445 | 4375340..4375774 | + | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR176_RS20450 | 4375753..4376586 | - | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
| MR176_RS20455 | 4376579..4379620 | - | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T295259 WP_003410811.1 NZ_OW052302:4375340-4375774 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FB09 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMN0 |