Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/- |
| Location | 4338386..4338915 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G0TMR4 |
| Locus tag | MR176_RS20235 | Protein ID | WP_003411124.1 |
| Coordinates | 4338598..4338915 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | P9WJ74 |
| Locus tag | MR176_RS20230 | Protein ID | WP_003411127.1 |
| Coordinates | 4338386..4338601 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS20200 | 4333492..4334268 | + | 777 | WP_003411137.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
| MR176_RS20205 | 4334334..4334990 | + | 657 | WP_003411133.1 | cell division protein SepF | - |
| MR176_RS20210 | 4335152..4335442 | + | 291 | WP_003900476.1 | YggT family protein | - |
| MR176_RS20215 | 4335710..4336492 | + | 783 | WP_003411131.1 | cell wall synthesis protein Wag31 | - |
| MR176_RS20220 | 4336587..4336943 | + | 357 | WP_003411130.1 | hypothetical protein | - |
| MR176_RS20225 | 4337073..4338131 | - | 1059 | WP_003411129.1 | phosphoribosyltransferase family protein | - |
| MR176_RS20230 | 4338386..4338601 | + | 216 | WP_003411127.1 | antitoxin ParD2 | Antitoxin |
| MR176_RS20235 | 4338598..4338915 | + | 318 | WP_003411124.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MR176_RS20245 | 4339386..4340732 | + | 1347 | WP_003411121.1 | M20/M25/M40 family metallo-hydrolase | - |
| MR176_RS20250 | 4340780..4341310 | + | 531 | WP_003411119.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
| MR176_RS20255 | 4341315..4342388 | - | 1074 | WP_003411116.1 | quinone-dependent dihydroorotate dehydrogenase | - |
| MR176_RS20260 | 4342424..4342705 | - | 282 | WP_003411112.1 | DUF5703 family protein | - |
| MR176_RS20265 | 4342702..4343778 | - | 1077 | WP_003411110.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12312.88 Da Isoelectric Point: 6.4831
>T295258 WP_003411124.1 NZ_OW052302:4338598-4338915 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FAJ4 |