Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3942549..3943201 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TPX1 |
Locus tag | MR176_RS18375 | Protein ID | WP_003412752.1 |
Coordinates | 3942549..3942974 (-) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ24 |
Locus tag | MR176_RS18380 | Protein ID | WP_003412749.1 |
Coordinates | 3942980..3943201 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS18350 | 3937554..3938111 | + | 558 | WP_003412768.1 | MaoC family dehydratase | - |
MR176_RS18355 | 3938108..3938929 | + | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
MR176_RS18360 | 3939188..3940291 | + | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
MR176_RS18365 | 3940302..3941348 | + | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
MR176_RS18370 | 3941345..3942526 | + | 1182 | WP_003899351.1 | dihydrolipoamide acetyltransferase family protein | - |
MR176_RS18375 | 3942549..3942974 | - | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR176_RS18380 | 3942980..3943201 | - | 222 | WP_003412749.1 | antitoxin | Antitoxin |
MR176_RS18385 | 3943254..3944006 | - | 753 | WP_003901416.1 | hypothetical protein | - |
MR176_RS18390 | 3943996..3944619 | - | 624 | WP_003900858.1 | TIGR00725 family protein | - |
MR176_RS18395 | 3944755..3944961 | + | 207 | WP_003899347.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T295257 WP_003412752.1 NZ_OW052302:c3942974-3942549 [Mycobacterium tuberculosis]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TPX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW03 |