Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3896377..3897017 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag MR176_RS18180 Protein ID WP_003412970.1
Coordinates 3896598..3897017 (+) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag MR176_RS18175 Protein ID WP_003412975.1
Coordinates 3896377..3896601 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS18155 3891994..3892557 + 564 WP_003412989.1 elongation factor P -
MR176_RS18160 3892560..3893030 + 471 WP_003899364.1 transcription antitermination factor NusB -
MR176_RS18165 3893030..3893431 + 402 WP_003412981.1 hypothetical protein -
MR176_RS18170 3893503..3896346 + 2844 WP_003899363.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
MR176_RS18175 3896377..3896601 + 225 WP_003412975.1 antitoxin VapB39 Antitoxin
MR176_RS18180 3896598..3897017 + 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
MR176_RS18185 3897018..3897968 - 951 WP_003911916.1 ERCC4 domain-containing protein -
MR176_RS18190 3898027..3898272 + 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
MR176_RS18195 3898613..3899533 + 921 WP_003412965.1 restriction endonuclease -
MR176_RS18200 3899568..3899969 - 402 WP_003412963.1 PIN domain-containing protein -
MR176_RS18205 3899966..3900193 - 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
MR176_RS18210 3900710..3901432 + 723 WP_003412957.1 DUF1906 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T295256 WP_003412970.1 NZ_OW052302:3896598-3897017 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT295256 WP_003412975.1 NZ_OW052302:3896377-3896601 [Mycobacterium tuberculosis]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References