Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3896377..3897017 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ08 |
Locus tag | MR176_RS18180 | Protein ID | WP_003412970.1 |
Coordinates | 3896598..3897017 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ09 |
Locus tag | MR176_RS18175 | Protein ID | WP_003412975.1 |
Coordinates | 3896377..3896601 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS18155 | 3891994..3892557 | + | 564 | WP_003412989.1 | elongation factor P | - |
MR176_RS18160 | 3892560..3893030 | + | 471 | WP_003899364.1 | transcription antitermination factor NusB | - |
MR176_RS18165 | 3893030..3893431 | + | 402 | WP_003412981.1 | hypothetical protein | - |
MR176_RS18170 | 3893503..3896346 | + | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
MR176_RS18175 | 3896377..3896601 | + | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
MR176_RS18180 | 3896598..3897017 | + | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR176_RS18185 | 3897018..3897968 | - | 951 | WP_003911916.1 | ERCC4 domain-containing protein | - |
MR176_RS18190 | 3898027..3898272 | + | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
MR176_RS18195 | 3898613..3899533 | + | 921 | WP_003412965.1 | restriction endonuclease | - |
MR176_RS18200 | 3899568..3899969 | - | 402 | WP_003412963.1 | PIN domain-containing protein | - |
MR176_RS18205 | 3899966..3900193 | - | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
MR176_RS18210 | 3900710..3901432 | + | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T295256 WP_003412970.1 NZ_OW052302:3896598-3897017 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|