Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 3882047..3882678 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag MR176_RS18085 Protein ID WP_003413174.1
Coordinates 3882047..3882424 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag MR176_RS18090 Protein ID WP_003413167.1
Coordinates 3882421..3882678 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS18050 3877514..3878026 + 513 WP_003413197.1 Holliday junction resolvase RuvX -
MR176_RS18055 3878019..3879272 + 1254 WP_003413196.1 endolytic transglycosylase MltG -
MR176_RS18060 3879269..3880078 + 810 WP_003413193.1 shikimate dehydrogenase -
MR176_RS18065 3880090..3880509 + 420 WP_003413190.1 A24 family peptidase -
MR176_RS18070 3880920..3881165 + 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
MR176_RS18075 3881162..3881557 + 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
MR176_RS18080 3881657..3882031 + 375 WP_003413177.1 hypothetical protein -
MR176_RS18085 3882047..3882424 - 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
MR176_RS18090 3882421..3882678 - 258 WP_003413167.1 CopG family transcriptional regulator Antitoxin
MR176_RS18095 3882717..3883130 - 414 WP_003413164.1 PIN domain nuclease -
MR176_RS18100 3883223..3883501 - 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
MR176_RS18105 3883498..3884160 - 663 WP_023643170.1 LppA family lipoprotein -
MR176_RS18110 3884157..3884816 - 660 WP_003900846.1 LppA family lipoprotein -
MR176_RS18115 3884943..3886154 - 1212 WP_003900845.1 alpha/beta hydrolase family protein -
MR176_RS18120 3886450..3886764 - 315 WP_009937839.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T295254 WP_003413174.1 NZ_OW052302:c3882424-3882047 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT295254 WP_003413167.1 NZ_OW052302:c3882678-3882421 [Mycobacterium tuberculosis]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References