Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3820501..3821215 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag MR176_RS17810 Protein ID WP_003413460.1
Coordinates 3820501..3820941 (-) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag MR176_RS17815 Protein ID WP_003413456.1
Coordinates 3820928..3821215 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS17785 3816413..3817087 - 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -
MR176_RS17790 3817215..3818114 + 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
MR176_RS17795 3818143..3818988 + 846 WP_003413466.1 acyl-CoA thioesterase II -
MR176_RS17800 3818996..3819592 + 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
MR176_RS17805 3819725..3820480 + 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
MR176_RS17810 3820501..3820941 - 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
MR176_RS17815 3820928..3821215 - 288 WP_003413456.1 antitoxin VapB41 Antitoxin
MR176_RS17820 3821326..3822897 - 1572 WP_003899392.1 polyamine aminopropyltransferase -
MR176_RS17825 3822894..3823352 - 459 WP_003413451.1 DUF350 domain-containing protein -
MR176_RS17830 3823377..3823808 - 432 WP_003899390.1 DUF4247 domain-containing protein -
MR176_RS17835 3823805..3824299 - 495 WP_003413444.1 DUF2617 family protein -
MR176_RS17840 3824310..3824930 - 621 WP_003413441.1 DUF4178 domain-containing protein -
MR176_RS17845 3825147..3825551 - 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
MR176_RS17850 3825548..3825793 - 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T295252 WP_003413460.1 NZ_OW052302:c3820941-3820501 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT295252 WP_003413456.1 NZ_OW052302:c3821215-3820928 [Mycobacterium tuberculosis]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References