Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3680062..3680749 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag MR176_RS16965 Protein ID WP_003414064.1
Coordinates 3680062..3680457 (+) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag MR176_RS16970 Protein ID WP_003414061.1
Coordinates 3680483..3680749 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS16930 3675959..3676696 - 738 WP_003414079.1 dienelactone hydrolase family protein -
MR176_RS16935 3676852..3677652 + 801 WP_003911953.1 thymidylate synthase -
MR176_RS16940 3677723..3678202 + 480 WP_003414073.1 dihydrofolate reductase -
MR176_RS16945 3678203..3678277 - 75 Protein_3353 hypothetical protein -
MR176_RS16950 3678276..3678695 + 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
MR176_RS16955 3678692..3679786 + 1095 WP_015630539.1 restriction endonuclease subunit S -
MR176_RS16960 3679796..3680065 + 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
MR176_RS16965 3680062..3680457 + 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
MR176_RS16970 3680483..3680749 + 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR176_RS16975 3680746..3681162 + 417 WP_003414059.1 type II toxin-antitoxin system toxin ribonuclease C21 -
MR176_RS16980 3681249..3682871 + 1623 WP_015630537.1 class I SAM-dependent DNA methyltransferase -
MR176_RS16985 3682868..3683143 + 276 WP_003414055.1 type I restriction endonuclease subunit S -
MR176_RS16995 3683387..3684139 + 753 WP_003899465.1 FAD-dependent thymidylate synthase -
MR176_RS17000 3684208..3685110 + 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T295249 WP_003414064.1 NZ_OW052302:3680062-3680457 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT295249 WP_003414061.1 NZ_OW052302:3680483-3680749 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References