Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3680062..3680749 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TF65 |
| Locus tag | MR176_RS16965 | Protein ID | WP_003414064.1 |
| Coordinates | 3680062..3680457 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TF64 |
| Locus tag | MR176_RS16970 | Protein ID | WP_003414061.1 |
| Coordinates | 3680483..3680749 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS16930 | 3675959..3676696 | - | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
| MR176_RS16935 | 3676852..3677652 | + | 801 | WP_003911953.1 | thymidylate synthase | - |
| MR176_RS16940 | 3677723..3678202 | + | 480 | WP_003414073.1 | dihydrofolate reductase | - |
| MR176_RS16945 | 3678203..3678277 | - | 75 | Protein_3353 | hypothetical protein | - |
| MR176_RS16950 | 3678276..3678695 | + | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
| MR176_RS16955 | 3678692..3679786 | + | 1095 | WP_015630539.1 | restriction endonuclease subunit S | - |
| MR176_RS16960 | 3679796..3680065 | + | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| MR176_RS16965 | 3680062..3680457 | + | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR176_RS16970 | 3680483..3680749 | + | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MR176_RS16975 | 3680746..3681162 | + | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
| MR176_RS16980 | 3681249..3682871 | + | 1623 | WP_015630537.1 | class I SAM-dependent DNA methyltransferase | - |
| MR176_RS16985 | 3682868..3683143 | + | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
| MR176_RS16995 | 3683387..3684139 | + | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
| MR176_RS17000 | 3684208..3685110 | + | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T295249 WP_003414064.1 NZ_OW052302:3680062-3680457 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|