Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3640595..3641165 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | MR176_RS16745 | Protein ID | WP_003414166.1 |
Coordinates | 3640809..3641165 (+) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | MR176_RS16740 | Protein ID | WP_003901465.1 |
Coordinates | 3640595..3640825 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS16700 | 3636072..3636299 | - | 228 | Protein_3304 | hypothetical protein | - |
MR176_RS16705 | 3636533..3636706 | - | 174 | WP_234713711.1 | hypothetical protein | - |
MR176_RS16710 | 3637408..3637668 | - | 261 | Protein_3306 | transposase | - |
MR176_RS16715 | 3637885..3638076 | - | 192 | WP_003414184.1 | hypothetical protein | - |
MR176_RS16720 | 3638073..3638465 | - | 393 | WP_078397589.1 | hypothetical protein | - |
MR176_RS16725 | 3638613..3638867 | + | 255 | WP_155936531.1 | hypothetical protein | - |
MR176_RS16730 | 3639043..3639510 | - | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
MR176_RS16735 | 3639509..3640552 | + | 1044 | WP_016720604.1 | DUF2293 domain-containing protein | - |
MR176_RS16740 | 3640595..3640825 | + | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
MR176_RS16745 | 3640809..3641165 | + | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
MR176_RS16750 | 3641267..3642916 | - | 1650 | WP_003899485.1 | CocE/NonD family hydrolase | - |
MR176_RS16755 | 3642935..3643522 | - | 588 | WP_003914429.1 | DUF3558 family protein | - |
MR176_RS16760 | 3643695..3644021 | + | 327 | WP_003414157.1 | hypothetical protein | - |
MR176_RS16765 | 3644025..3645713 | + | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 3613990..3647516 | 33526 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T295248 WP_003414166.1 NZ_OW052302:3640809-3641165 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|