Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN_Sll0205-like-Phd |
| Location | 3614327..3614931 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P71623 |
| Locus tag | MR176_RS16595 | Protein ID | WP_003414492.1 |
| Coordinates | 3614539..3614931 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A829CBY8 |
| Locus tag | MR176_RS16590 | Protein ID | WP_003414495.1 |
| Coordinates | 3614327..3614542 (+) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS16565 | 3609329..3610240 | + | 912 | WP_003414505.1 | sugar ABC transporter permease | - |
| MR176_RS16570 | 3610237..3611064 | + | 828 | WP_003414504.1 | carbohydrate ABC transporter permease | - |
| MR176_RS16575 | 3611067..3612377 | + | 1311 | WP_003414501.1 | ABC transporter substrate-binding protein | - |
| MR176_RS16580 | 3612370..3613452 | + | 1083 | WP_003414499.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| MR176_RS16585 | 3613531..3614280 | - | 750 | WP_003414497.1 | enoyl-CoA hydratase | - |
| MR176_RS16590 | 3614327..3614542 | + | 216 | WP_003414495.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MR176_RS16595 | 3614539..3614931 | + | 393 | WP_003414492.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR176_RS16600 | 3614952..3615221 | + | 270 | WP_003414489.1 | DUF2277 family protein | - |
| MR176_RS16605 | 3615218..3615763 | + | 546 | WP_019284034.1 | DUF1802 family protein | - |
| MR176_RS16610 | 3616068..3616955 | + | 888 | WP_015630563.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| MR176_RS16615 | 3616958..3617842 | + | 885 | WP_003414409.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| MR176_RS16620 | 3618114..3618659 | + | 546 | WP_014584866.1 | DUF1802 family protein | - |
| MR176_RS16625 | 3618993..3619781 | + | 789 | WP_003917092.1 | CRISPR-associated endoribonuclease Cas6 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3613990..3647516 | 33526 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14610.74 Da Isoelectric Point: 6.7594
>T295246 WP_003414492.1 NZ_OW052302:3614539-3614931 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BWM8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CBY8 |