Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 3573466..3574014 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TFG5 |
| Locus tag | MR176_RS16400 | Protein ID | WP_003414602.1 |
| Coordinates | 3573466..3573729 (-) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | O33347 |
| Locus tag | MR176_RS16405 | Protein ID | WP_003414599.1 |
| Coordinates | 3573733..3574014 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS16380 | 3568540..3569781 | + | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| MR176_RS16385 | 3569789..3571003 | + | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| MR176_RS16390 | 3571020..3572183 | + | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| MR176_RS16395 | 3572239..3573093 | + | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
| MR176_RS16400 | 3573466..3573729 | - | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| MR176_RS16405 | 3573733..3574014 | - | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
| MR176_RS16410 | 3574286..3576097 | + | 1812 | WP_003414596.1 | penicillin-binding protein | - |
| MR176_RS16415 | 3576179..3576559 | - | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR176_RS16420 | 3576556..3576804 | - | 249 | WP_003913411.1 | antitoxin VapB23 | - |
| MR176_RS16425 | 3576908..3577492 | + | 585 | WP_003414585.1 | DUF1707 domain-containing protein | - |
| MR176_RS16430 | 3577534..3578391 | + | 858 | WP_016719566.1 | type I methionyl aminopeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T295245 WP_003414602.1 NZ_OW052302:c3573729-3573466 [Mycobacterium tuberculosis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3G5O |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3G5O | |
| AlphaFold DB | A0A7U4BWP8 |