Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3567726..3568413 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P65044 |
| Locus tag | MR176_RS16370 | Protein ID | WP_003414624.1 |
| Coordinates | 3567726..3568169 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TFH0 |
| Locus tag | MR176_RS16375 | Protein ID | WP_003414620.1 |
| Coordinates | 3568156..3568413 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS16345 | 3563574..3563840 | - | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
| MR176_RS16350 | 3563940..3564521 | - | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
| MR176_RS16355 | 3564617..3566365 | - | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
| MR176_RS16360 | 3566697..3566888 | - | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| MR176_RS16365 | 3566984..3567646 | - | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
| MR176_RS16370 | 3567726..3568169 | - | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR176_RS16375 | 3568156..3568413 | - | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| MR176_RS16380 | 3568540..3569781 | + | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| MR176_RS16385 | 3569789..3571003 | + | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| MR176_RS16390 | 3571020..3572183 | + | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| MR176_RS16395 | 3572239..3573093 | + | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T295244 WP_003414624.1 NZ_OW052302:c3568169-3567726 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|