Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3044234..3044908 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P9WF52
Locus tag MR176_RS14015 Protein ID WP_003417282.1
Coordinates 3044480..3044908 (+) Length 143 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TI59
Locus tag MR176_RS14010 Protein ID WP_003417286.1
Coordinates 3044234..3044476 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS13985 3040698..3041834 + 1137 WP_003417297.1 GTP 3',8-cyclase MoaA -
MR176_RS13990 3041931..3042305 + 375 WP_003417295.1 4a-hydroxytetrahydrobiopterin dehydratase -
MR176_RS13995 3042302..3042835 + 534 WP_003417293.1 cyclic pyranopterin monophosphate synthase MoaC -
MR176_RS14000 3042836..3043501 + 666 WP_003417290.1 molybdopterin converting factor subunit 1 -
MR176_RS14005 3043498..3044112 + 615 WP_003417288.1 class I SAM-dependent methyltransferase -
MR176_RS14010 3044234..3044476 + 243 WP_003417286.1 CopG family transcriptional regulator Antitoxin
MR176_RS14015 3044480..3044908 + 429 WP_003417282.1 type II toxin-antitoxin system VapC family toxin Toxin
MR176_RS14020 3044987..3045778 - 792 WP_003417279.1 succinate dehydrogenase iron-sulfur subunit -
MR176_RS14025 3045778..3047550 - 1773 WP_031651194.1 succinate dehydrogenase flavoprotein subunit -
MR176_RS14030 3047679..3048113 - 435 WP_003417269.1 succinate dehydrogenase hydrophobic membrane anchor subunit -
MR176_RS14035 3048110..3048448 - 339 WP_003417267.1 succinate dehydrogenase, cytochrome b556 subunit -
MR176_RS14040 3048685..3049086 + 402 WP_003417264.1 cytidine deaminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-141)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15834.16 Da        Isoelectric Point: 8.5471

>T295242 WP_003417282.1 NZ_OW052302:3044480-3044908 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL

Download         Length: 429 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8849.86 Da        Isoelectric Point: 5.1007

>AT295242 WP_003417286.1 NZ_OW052302:3044234-3044476 [Mycobacterium tuberculosis]
MRTTLSIDDDVLLAVKERARREKRTAGEILSDLARQALTNQNPQPAASQEDAFHGFEPLPHRGGAVSNALIDRLRDEEAV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4FBL0

Antitoxin

Source ID Structure
AlphaFold DB G0TI59

References