Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-PHD |
| Location | 2948182..2948849 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | MR176_RS13680 | Protein ID | WP_016719661.1 |
| Coordinates | 2948457..2948849 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
| Locus tag | MR176_RS13675 | Protein ID | WP_003912214.1 |
| Coordinates | 2948182..2948457 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS13660 | 2943301..2944173 | + | 873 | WP_003417929.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
| MR176_RS13665 | 2944244..2946439 | - | 2196 | WP_010886168.1 | PE family protein | - |
| MR176_RS13670 | 2946629..2948000 | - | 1372 | Protein_2702 | ISNCY family transposase | - |
| MR176_RS13675 | 2948182..2948457 | + | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MR176_RS13680 | 2948457..2948849 | + | 393 | WP_016719661.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR176_RS13685 | 2949603..2950655 | + | 1053 | WP_003900678.1 | polyprenyl synthetase family protein | - |
| MR176_RS13690 | 2950655..2951644 | + | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| MR176_RS13695 | 2951641..2953479 | + | 1839 | WP_003918607.1 | 1-deoxy-D-xylulose-5-phosphate synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2946629..2947306 | 677 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14346.77 Da Isoelectric Point: 10.7249
>T295240 WP_016719661.1 NZ_OW052302:2948457-2948849 [Mycobacterium tuberculosis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARTEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARTEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|