Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-PHD |
Location | 2920959..2921644 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TIR9 |
Locus tag | MR176_RS13555 | Protein ID | WP_003417998.1 |
Coordinates | 2920959..2921369 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | MR176_RS13560 | Protein ID | WP_003912220.1 |
Coordinates | 2921366..2921644 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS13540 | 2916398..2917987 | + | 1590 | WP_003900682.1 | IMP dehydrogenase | - |
MR176_RS13545 | 2918007..2919134 | + | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
MR176_RS13550 | 2919190..2920926 | + | 1737 | WP_003418002.1 | cholesterol oxidase | - |
MR176_RS13555 | 2920959..2921369 | - | 411 | WP_003417998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR176_RS13560 | 2921366..2921644 | - | 279 | WP_003912220.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MR176_RS13565 | 2921700..2922587 | - | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
MR176_RS13570 | 2922649..2923215 | + | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
MR176_RS13575 | 2923333..2924037 | + | 705 | WP_003417980.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
MR176_RS13580 | 2924054..2925655 | + | 1602 | WP_003417969.1 | FAD/NAD(P)-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14695.84 Da Isoelectric Point: 5.1784
>T295239 WP_003417998.1 NZ_OW052302:c2921369-2920959 [Mycobacterium tuberculosis]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|