Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Rv0299-vapB/- |
Location | 1968010..1968581 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | Rv0299 | Uniprot ID | - |
Locus tag | MR176_RS09275 | Protein ID | WP_015629470.1 |
Coordinates | 1968279..1968581 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O07227 |
Locus tag | MR176_RS09270 | Protein ID | WP_003401563.1 |
Coordinates | 1968010..1968231 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS09255 | 1965916..1966824 | - | 909 | WP_003900117.1 | protochlorophyllide reductase | - |
MR176_RS09260 | 1966821..1967453 | - | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
MR176_RS09265 | 1967588..1968013 | - | 426 | WP_003401566.1 | PIN domain nuclease | - |
MR176_RS09270 | 1968010..1968231 | - | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
MR176_RS09275 | 1968279..1968581 | - | 303 | WP_015629470.1 | toxin-antitoxin system toxin | Toxin |
MR176_RS09280 | 1968578..1968805 | - | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
MR176_RS09285 | 1968948..1970723 | - | 1776 | WP_010886074.1 | PE family protein | - |
MR176_RS09290 | 1970902..1972299 | + | 1398 | WP_003401544.1 | sulfatase | - |
MR176_RS09295 | 1972309..1973112 | + | 804 | WP_003401540.1 | Stf0 family sulphotransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10472.19 Da Isoelectric Point: 4.9609
>T295236 WP_015629470.1 NZ_OW052302:c1968581-1968279 [Mycobacterium tuberculosis]
MIAPGDIAPRRDSEHELYVAVLSNALHRATDTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRATDTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|