Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-CcdA |
| Location | 1689842..1690518 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPQ9 |
| Locus tag | MR176_RS07975 | Protein ID | WP_003898500.1 |
| Coordinates | 1690105..1690518 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TPR0 |
| Locus tag | MR176_RS07970 | Protein ID | WP_003402915.1 |
| Coordinates | 1689842..1690108 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS07955 | 1685276..1686256 | - | 981 | WP_003402923.1 | o-succinylbenzoate synthase | - |
| MR176_RS07960 | 1686253..1687857 | - | 1605 | WP_003402920.1 | amidohydrolase | - |
| MR176_RS07965 | 1687935..1689650 | + | 1716 | WP_003402917.1 | fatty-acid--CoA ligase FadD8 | - |
| MR176_RS07970 | 1689842..1690108 | + | 267 | WP_003402915.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| MR176_RS07975 | 1690105..1690518 | + | 414 | WP_003898500.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR176_RS07980 | 1690832..1691734 | + | 903 | WP_003915439.1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase | - |
| MR176_RS07985 | 1691830..1692714 | + | 885 | WP_003402909.1 | SDR family oxidoreductase | - |
| MR176_RS07990 | 1692777..1693163 | + | 387 | WP_003402907.1 | VOC family protein | - |
| MR176_RS07995 | 1693283..1694536 | + | 1254 | WP_003402904.1 | inorganic phosphate transporter | - |
| MR176_RS08000 | 1694533..1694811 | + | 279 | WP_003402901.1 | hypothetical protein | - |
| MR176_RS08005 | 1694871..1695173 | + | 303 | WP_003402896.1 | DUF3349 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14667.78 Da Isoelectric Point: 7.3603
>T295233 WP_003898500.1 NZ_OW052302:1690105-1690518 [Mycobacterium tuberculosis]
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
VRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDAEVLSALGRMQRAGALTVAYVDAALEELRQV
PVTRHGLSSLLAGAWSRRDTLRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|