Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-PHD
Location 1635259..1635905 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID O07783
Locus tag MR176_RS07740 Protein ID WP_003403122.1
Coordinates 1635513..1635905 (+) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ86
Locus tag MR176_RS07735 Protein ID WP_003403125.1
Coordinates 1635259..1635516 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS07700 1630577..1630888 - 312 WP_003403164.1 hypothetical protein -
MR176_RS07705 1631011..1631706 + 696 WP_003918099.1 two-component system response regulator TcrA -
MR176_RS07710 1631690..1632220 + 531 WP_003917320.1 two component system sensor kinase HK2 -
MR176_RS07715 1632334..1632840 + 507 WP_003900973.1 two component system sensor kinase HK1 -
MR176_RS07720 1632944..1633180 + 237 WP_003403139.1 type II toxin-antitoxin system antitoxin VapB27 -
MR176_RS07725 1633177..1633590 + 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin -
MR176_RS07730 1633841..1635076 + 1236 WP_003403128.1 ATP-binding protein -
MR176_RS07735 1635259..1635516 + 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 Antitoxin
MR176_RS07740 1635513..1635905 + 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 Toxin
MR176_RS07745 1635957..1637507 - 1551 WP_003403119.1 MlaD family protein -
MR176_RS07750 1637512..1638654 - 1143 WP_003911253.1 virulence factor Mce family protein -
MR176_RS07755 1638717..1640244 - 1528 Protein_1530 virulence factor Mce family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(8-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-53)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14080.08 Da        Isoelectric Point: 4.6558

>T295231 WP_003403122.1 NZ_OW052302:1635513-1635905 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI

Download         Length: 393 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9681.06 Da        Isoelectric Point: 7.0175

>AT295231 WP_003403125.1 NZ_OW052302:1635259-1635516 [Mycobacterium tuberculosis]
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTT
DDVRW

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4F8V4

Antitoxin

Source ID Structure
AlphaFold DB G0TQ86

References