Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
| Location | 1635259..1635905 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O07783 |
| Locus tag | MR176_RS07740 | Protein ID | WP_003403122.1 |
| Coordinates | 1635513..1635905 (+) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ86 |
| Locus tag | MR176_RS07735 | Protein ID | WP_003403125.1 |
| Coordinates | 1635259..1635516 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS07700 | 1630577..1630888 | - | 312 | WP_003403164.1 | hypothetical protein | - |
| MR176_RS07705 | 1631011..1631706 | + | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| MR176_RS07710 | 1631690..1632220 | + | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| MR176_RS07715 | 1632334..1632840 | + | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
| MR176_RS07720 | 1632944..1633180 | + | 237 | WP_003403139.1 | type II toxin-antitoxin system antitoxin VapB27 | - |
| MR176_RS07725 | 1633177..1633590 | + | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR176_RS07730 | 1633841..1635076 | + | 1236 | WP_003403128.1 | ATP-binding protein | - |
| MR176_RS07735 | 1635259..1635516 | + | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | Antitoxin |
| MR176_RS07740 | 1635513..1635905 | + | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | Toxin |
| MR176_RS07745 | 1635957..1637507 | - | 1551 | WP_003403119.1 | MlaD family protein | - |
| MR176_RS07750 | 1637512..1638654 | - | 1143 | WP_003911253.1 | virulence factor Mce family protein | - |
| MR176_RS07755 | 1638717..1640244 | - | 1528 | Protein_1530 | virulence factor Mce family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14080.08 Da Isoelectric Point: 4.6558
>T295231 WP_003403122.1 NZ_OW052302:1635513-1635905 [Mycobacterium tuberculosis]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4F8V4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ86 |