Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 1626857..1627500 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag MR176_RS07670 Protein ID WP_003403187.1
Coordinates 1626857..1627258 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag MR176_RS07675 Protein ID WP_003403184.1
Coordinates 1627255..1627500 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS07645 1623815..1624420 - 606 WP_003898526.1 hypothetical protein -
MR176_RS07650 1624562..1624783 + 222 WP_003898525.1 DUF4926 domain-containing protein -
MR176_RS07655 1624835..1625992 + 1158 WP_003898524.1 hypothetical protein -
MR176_RS07660 1626072..1626269 + 198 WP_003403191.1 hypothetical protein -
MR176_RS07665 1626687..1626866 - 180 Protein_1512 hypothetical protein -
MR176_RS07670 1626857..1627258 - 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
MR176_RS07675 1627255..1627500 - 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR176_RS07680 1627545..1628015 - 471 WP_003898523.1 hypothetical protein -
MR176_RS07685 1628018..1628728 - 711 Protein_1516 IS607 family element RNA-guided endonuclease TnpB -
MR176_RS07690 1628730..1629314 - 585 WP_003403171.1 IS607-like element IS1536 family transposase -
MR176_RS07695 1629555..1630505 - 951 WP_003900184.1 DUF1259 domain-containing protein -
MR176_RS07700 1630577..1630888 - 312 WP_003403164.1 hypothetical protein -
MR176_RS07705 1631011..1631706 + 696 WP_003918099.1 two-component system response regulator TcrA -
MR176_RS07710 1631690..1632220 + 531 WP_003917320.1 two component system sensor kinase HK2 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T295229 WP_003403187.1 NZ_OW052302:c1627258-1626857 [Mycobacterium tuberculosis]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT295229 WP_003403184.1 NZ_OW052302:c1627500-1627255 [Mycobacterium tuberculosis]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References