Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1619337..1619962 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | MR176_RS07620 | Protein ID | WP_003403218.1 |
| Coordinates | 1619337..1619738 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | MR176_RS07625 | Protein ID | WP_003403213.1 |
| Coordinates | 1619735..1619962 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS07595 | 1614427..1615374 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| MR176_RS07600 | 1615478..1616542 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
| MR176_RS07605 | 1616937..1618028 | - | 1092 | WP_003900977.1 | galactokinase | - |
| MR176_RS07610 | 1618025..1619106 | - | 1082 | Protein_1501 | galactose-1-phosphate uridylyltransferase | - |
| MR176_RS07615 | 1619125..1619208 | - | 84 | Protein_1502 | galactose-1-phosphate uridylyltransferase | - |
| MR176_RS07620 | 1619337..1619738 | - | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| MR176_RS07625 | 1619735..1619962 | - | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| MR176_RS07630 | 1620157..1620399 | - | 243 | WP_003403210.1 | hypothetical protein | - |
| MR176_RS07635 | 1620396..1621145 | - | 750 | WP_003898528.1 | hypothetical protein | - |
| MR176_RS07640 | 1621229..1623796 | + | 2568 | WP_031651119.1 | SEC-C metal-binding domain-containing protein | - |
| MR176_RS07645 | 1623815..1624420 | - | 606 | WP_003898526.1 | hypothetical protein | - |
| MR176_RS07650 | 1624562..1624783 | + | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T295228 WP_003403218.1 NZ_OW052302:c1619738-1619337 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |