Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1613685..1614334 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | MR176_RS07585 | Protein ID | WP_003403236.1 |
Coordinates | 1613685..1614080 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | MR176_RS07590 | Protein ID | WP_003403235.1 |
Coordinates | 1614080..1614334 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS07560 | 1609012..1610739 | + | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
MR176_RS07565 | 1610832..1611983 | + | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
MR176_RS07570 | 1612055..1612462 | - | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
MR176_RS07575 | 1612459..1612719 | - | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR176_RS07580 | 1612851..1613591 | + | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
MR176_RS07585 | 1613685..1614080 | - | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
MR176_RS07590 | 1614080..1614334 | - | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
MR176_RS07595 | 1614427..1615374 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
MR176_RS07600 | 1615478..1616542 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
MR176_RS07605 | 1616937..1618028 | - | 1092 | WP_003900977.1 | galactokinase | - |
MR176_RS07610 | 1618025..1619106 | - | 1082 | Protein_1501 | galactose-1-phosphate uridylyltransferase | - |
MR176_RS07615 | 1619125..1619208 | - | 84 | Protein_1502 | galactose-1-phosphate uridylyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T295227 WP_003403236.1 NZ_OW052302:c1614080-1613685 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC2 |