295225

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1576593..1577226 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag MR176_RS07400 Protein ID WP_015629650.1
Coordinates 1576843..1577226 (+) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag MR176_RS07395 Protein ID WP_003403368.1
Coordinates 1576593..1576748 (+) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS07365 1571710..1574073 - 2364 WP_003403397.1 arylsulfatase AtsD -
MR176_RS07370 1574187..1574441 + 255 WP_003911263.1 antitoxin VapB7 -
MR176_RS07375 1574438..1574875 + 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
MR176_RS07380 1574985..1575230 + 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
MR176_RS07385 1575217..1575525 + 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
MR176_RS07390 1575801..1576517 + 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
MR176_RS07395 1576593..1576748 + 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
MR176_RS07400 1576843..1577226 + 384 WP_015629650.1 hypothetical protein Toxin
MR176_RS07405 1577614..1578624 - 1011 WP_003911248.1 ABC transporter ATP-binding protein -
MR176_RS07410 1578705..1580211 - 1507 Protein_1464 carotenoid cleavage oxygenase -
MR176_RS07415 1580282..1580977 + 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
MR176_RS07420 1580970..1581362 - 393 WP_003403353.1 50S ribosomal protein L7/L12 -
MR176_RS07425 1581399..1581935 - 537 WP_003403341.1 50S ribosomal protein L10 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13886.68 Da        Isoelectric Point: 6.0803

>T295225 WP_015629650.1 NZ_OW052302:1576843-1577226 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRLIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT295225 WP_003403368.1 NZ_OW052302:1576593-1576748 [Mycobacterium tuberculosis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References