Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1098014..1098645 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
| Locus tag | MR176_RS04995 | Protein ID | WP_003405820.1 |
| Coordinates | 1098334..1098645 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TGZ7 |
| Locus tag | MR176_RS04990 | Protein ID | WP_003405836.1 |
| Coordinates | 1098014..1098334 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS04965 | 1093210..1093848 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
| MR176_RS04970 | 1093845..1095092 | + | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
| MR176_RS04975 | 1095082..1095339 | + | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
| MR176_RS04980 | 1095349..1096461 | + | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
| MR176_RS04985 | 1096468..1098004 | - | 1537 | Protein_989 | carboxylesterase/lipase family protein | - |
| MR176_RS04990 | 1098014..1098334 | + | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
| MR176_RS04995 | 1098334..1098645 | + | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
| MR176_RS05000 | 1098757..1099914 | + | 1158 | WP_003898727.1 | AI-2E family transporter | - |
| MR176_RS05005 | 1099921..1100565 | - | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
| MR176_RS05010 | 1100621..1101709 | + | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
| MR176_RS05015 | 1101740..1103164 | + | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T295218 WP_003405820.1 NZ_OW052302:1098334-1098645 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4F9D0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TGZ7 |