Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1089321..1089889 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TH08 |
| Locus tag | MR176_RS04940 | Protein ID | WP_003405865.1 |
| Coordinates | 1089321..1089695 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TH07 |
| Locus tag | MR176_RS04945 | Protein ID | WP_003405863.1 |
| Coordinates | 1089692..1089889 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS04905 | 1085671..1086441 | + | 771 | Protein_973 | adenylate/guanylate cyclase domain-containing protein | - |
| MR176_RS04910 | 1086393..1086602 | - | 210 | WP_003911400.1 | hypothetical protein | - |
| MR176_RS04915 | 1086636..1087334 | + | 699 | WP_031646953.1 | hypothetical protein | - |
| MR176_RS04920 | 1087349..1087672 | - | 324 | WP_003405871.1 | putative quinol monooxygenase | - |
| MR176_RS04925 | 1087915..1088190 | + | 276 | WP_003405867.1 | hypothetical protein | - |
| MR176_RS04930 | 1088117..1088302 | - | 186 | WP_003901093.1 | hypothetical protein | - |
| MR176_RS04935 | 1088420..1089118 | - | 699 | WP_016719357.1 | hypothetical protein | - |
| MR176_RS04940 | 1089321..1089695 | - | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR176_RS04945 | 1089692..1089889 | - | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MR176_RS04950 | 1089977..1091050 | - | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
| MR176_RS04955 | 1091113..1092096 | + | 984 | WP_003898731.1 | hypothetical protein | - |
| MR176_RS04960 | 1092113..1093120 | - | 1008 | WP_015629829.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| MR176_RS04965 | 1093210..1093848 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T295217 WP_003405865.1 NZ_OW052302:c1089695-1089321 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|