Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 944420..945108 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0THR7 |
Locus tag | MR176_RS04280 | Protein ID | WP_003406304.1 |
Coordinates | 944420..944851 (-) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0THR6 |
Locus tag | MR176_RS04285 | Protein ID | WP_003406302.1 |
Coordinates | 944848..945108 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS04255 | 940143..940412 | + | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
MR176_RS04260 | 940409..940702 | + | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | - |
MR176_RS04265 | 940759..941589 | + | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
MR176_RS04270 | 941670..942530 | - | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
MR176_RS04275 | 942710..944397 | + | 1688 | Protein_846 | PE family protein | - |
MR176_RS04280 | 944420..944851 | - | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR176_RS04285 | 944848..945108 | - | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | Antitoxin |
MR176_RS04290 | 945184..946173 | - | 990 | WP_003406301.1 | malate dehydrogenase | - |
MR176_RS04295 | 946344..947444 | + | 1101 | WP_003406300.1 | magnesium/cobalt transporter CorA | - |
MR176_RS04300 | 947521..948702 | - | 1182 | WP_003406299.1 | trehalose ABC transporter ATP-binding protein SugC | - |
MR176_RS04305 | 948707..949531 | - | 825 | WP_003900298.1 | trehalose ABC transporter permease SugB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T295216 WP_003406304.1 NZ_OW052302:c944851-944420 [Mycobacterium tuberculosis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|