Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 940143..940702 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0THS1 |
| Locus tag | MR176_RS04260 | Protein ID | WP_003898789.1 |
| Coordinates | 940409..940702 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0THS2 |
| Locus tag | MR176_RS04255 | Protein ID | WP_003406322.1 |
| Coordinates | 940143..940412 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS04245 | 935405..936193 | + | 789 | WP_003406325.1 | hypothetical protein | - |
| MR176_RS04250 | 936335..940030 | + | 3696 | WP_003406323.1 | multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit | - |
| MR176_RS04255 | 940143..940412 | + | 270 | WP_003406322.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| MR176_RS04260 | 940409..940702 | + | 294 | WP_003898789.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| MR176_RS04265 | 940759..941589 | + | 831 | WP_003898788.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| MR176_RS04270 | 941670..942530 | - | 861 | WP_003900301.1 | glycine betaine ABC transporter substrate-binding protein | - |
| MR176_RS04275 | 942710..944397 | + | 1688 | Protein_846 | PE family protein | - |
| MR176_RS04280 | 944420..944851 | - | 432 | WP_003406304.1 | type II toxin-antitoxin system VapC family toxin | - |
| MR176_RS04285 | 944848..945108 | - | 261 | WP_003406302.1 | type II toxin-antitoxin system antitoxin VapB33 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11031.57 Da Isoelectric Point: 9.6275
>T295215 WP_003898789.1 NZ_OW052302:940409-940702 [Mycobacterium tuberculosis]
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEII
HIARRSASYRMNPCRPR
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|