Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 641766..642382 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TJ74 |
| Locus tag | MR176_RS02945 | Protein ID | WP_003407593.1 |
| Coordinates | 641766..642083 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TJ73 |
| Locus tag | MR176_RS02950 | Protein ID | WP_003900349.1 |
| Coordinates | 642080..642382 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS02915 | 636775..637803 | - | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
| MR176_RS02920 | 637848..638246 | - | 399 | WP_003900351.1 | hypothetical protein | - |
| MR176_RS02925 | 638307..638519 | + | 213 | WP_003898900.1 | dodecin family protein | - |
| MR176_RS02930 | 638640..639350 | + | 711 | WP_235639255.1 | class I SAM-dependent methyltransferase | - |
| MR176_RS02935 | 639423..640712 | - | 1290 | WP_003407599.1 | serine hydrolase domain-containing protein | - |
| MR176_RS02940 | 640765..641769 | - | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
| MR176_RS02945 | 641766..642083 | - | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
| MR176_RS02950 | 642080..642382 | - | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
| MR176_RS02955 | 642396..644648 | - | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
| MR176_RS02960 | 644649..646496 | - | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T295212 WP_003407593.1 NZ_OW052302:c642083-641766 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|