Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 562700..563313 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64880 |
Locus tag | MR176_RS02595 | Protein ID | WP_003407786.1 |
Coordinates | 562700..563104 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
Locus tag | MR176_RS02600 | Protein ID | WP_009935474.1 |
Coordinates | 563110..563313 (-) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS02585 | 558651..560948 | + | 2298 | WP_003407790.1 | malto-oligosyltrehalose synthase | - |
MR176_RS02590 | 560941..562683 | + | 1743 | WP_003407788.1 | malto-oligosyltrehalose trehalohydrolase | - |
MR176_RS02595 | 562700..563104 | - | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
MR176_RS02600 | 563110..563313 | - | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR176_RS02605 | 563366..564655 | - | 1290 | WP_016719220.1 | threonine ammonia-lyase | - |
MR176_RS02610 | 564690..565136 | - | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
MR176_RS02615 | 565146..566294 | - | 1149 | Protein_521 | MMPL family transporter | - |
MR176_RS02620 | 566478..567086 | - | 609 | WP_003407773.1 | TetR/AcrR family transcriptional regulator | - |
MR176_RS02625 | 567154..567531 | - | 378 | WP_003407771.1 | fumarate reductase subunit FrdD | - |
MR176_RS02630 | 567528..567908 | - | 381 | WP_031651142.1 | fumarate reductase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T295211 WP_003407786.1 NZ_OW052302:c563104-562700 [Mycobacterium tuberculosis]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|