Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 380387..381000 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFA2 |
Locus tag | MR176_RS01775 | Protein ID | WP_003408465.1 |
Coordinates | 380611..381000 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ52 |
Locus tag | MR176_RS01770 | Protein ID | WP_003408469.1 |
Coordinates | 380387..380614 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS01750 | 376279..376989 | + | 711 | WP_003408486.1 | winged helix-turn-helix transcriptional regulator | - |
MR176_RS01755 | 376979..377398 | + | 420 | WP_003408483.1 | hypothetical protein | - |
MR176_RS01760 | 377441..378688 | - | 1248 | WP_003408476.1 | serine hydrolase | - |
MR176_RS01765 | 378685..380169 | - | 1485 | WP_003408473.1 | biotin carboxylase | - |
MR176_RS01770 | 380387..380614 | + | 228 | WP_003408469.1 | antitoxin | Antitoxin |
MR176_RS01775 | 380611..381000 | + | 390 | WP_003408465.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
MR176_RS01780 | 381048..381179 | - | 132 | Protein_356 | IS3 family transposase | - |
MR176_RS01790 | 381610..382389 | - | 780 | WP_003408460.1 | IclR family transcriptional regulator | - |
MR176_RS01795 | 382403..383221 | - | 819 | WP_003408456.1 | 3-keto-5-aminohexanoate cleavage protein | - |
MR176_RS01800 | 383274..383624 | - | 351 | WP_003898986.1 | cupin domain-containing protein | - |
MR176_RS01805 | 383624..384454 | - | 831 | WP_003408448.1 | cyclase family protein | - |
MR176_RS01810 | 384457..385371 | - | 915 | WP_003898985.1 | 3-hydroxyacyl-CoA dehydrogenase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 13817.98 Da Isoelectric Point: 7.0612
>T295210 WP_003408465.1 NZ_OW052302:380611-381000 [Mycobacterium tuberculosis]
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
VIVLDASAAVELMLTTPAGAAVARRLRGETVHAPAHFDVEVIGAIRQAVVRQLISDHEGLVVVVNFLSLPVRRWPLKPFT
QRAYQLRSTHTVADGAYVALAEGLGVPLITCDGRLAQSHGHNAEIELVA
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUI9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7E4J | |
AlphaFold DB | A0A7U4FAN9 |