Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 127975..128678 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLK7 |
Locus tag | MR176_RS00655 | Protein ID | WP_003409778.1 |
Coordinates | 128349..128678 (+) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TLK8 |
Locus tag | MR176_RS00650 | Protein ID | WP_003409780.1 |
Coordinates | 127975..128352 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS00610 | 123133..123324 | + | 192 | WP_003409876.1 | hypothetical protein | - |
MR176_RS00615 | 123345..124247 | + | 903 | WP_003899097.1 | hypothetical protein | - |
MR176_RS00620 | 124258..124608 | + | 351 | WP_003409871.1 | hypothetical protein | - |
MR176_RS00625 | 124722..124904 | + | 183 | WP_003409870.1 | hypothetical protein | - |
MR176_RS00630 | 124897..125298 | - | 402 | WP_003409869.1 | hypothetical protein | - |
MR176_RS00635 | 125362..125814 | + | 453 | WP_003899095.1 | lipoprotein | - |
MR176_RS00640 | 125969..127333 | - | 1365 | WP_003903691.1 | HNH endonuclease signature motif containing protein | - |
MR176_RS00645 | 127388..127978 | + | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
MR176_RS00650 | 127975..128352 | + | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
MR176_RS00655 | 128349..128678 | + | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MR176_RS00660 | 128888..129658 | - | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
MR176_RS00665 | 129655..130716 | - | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
MR176_RS00670 | 130713..131228 | - | 516 | WP_003409718.1 | flavin reductase family protein | - |
MR176_RS00675 | 131225..132295 | - | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T295208 WP_003409778.1 NZ_OW052302:128349-128678 [Mycobacterium tuberculosis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT295208 WP_003409780.1 NZ_OW052302:127975-128352 [Mycobacterium tuberculosis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|