295206

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 119097..119641 Replicon chromosome
Accession NZ_OW052302
Organism Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag MR176_RS00565 Protein ID WP_003409896.1
Coordinates 119345..119641 (+) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag MR176_RS00560 Protein ID WP_003409899.1
Coordinates 119097..119348 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR176_RS00535 114824..115621 - 798 WP_003899101.1 ABC transporter permease -
MR176_RS00540 116520..117740 + 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
MR176_RS00545 117773..118045 + 273 WP_031651155.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
MR176_RS00550 118049..118456 + 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
MR176_RS00555 118616..119110 - 495 WP_003899099.1 hypothetical protein -
MR176_RS00560 119097..119348 + 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
MR176_RS00565 119345..119641 + 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MR176_RS00570 119690..120304 + 615 WP_003901296.1 hypothetical protein -
MR176_RS00575 120193..120738 - 546 WP_003409891.1 SecB-like chaperone -
MR176_RS00580 120735..121184 - 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
MR176_RS00585 121226..121603 - 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
MR176_RS00590 121578..122099 + 522 WP_003904745.1 hypothetical protein -
MR176_RS00595 122073..122384 - 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
MR176_RS00600 122381..122596 - 216 WP_003409878.1 antitoxin -
MR176_RS00605 122836..123132 + 297 WP_003409877.1 hypothetical protein -
MR176_RS00610 123133..123324 + 192 WP_003409876.1 hypothetical protein -
MR176_RS00615 123345..124247 + 903 WP_003899097.1 hypothetical protein -
MR176_RS00620 124258..124608 + 351 WP_003409871.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T295206 WP_003409896.1 NZ_OW052302:119345-119641 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT295206 WP_003409899.1 NZ_OW052302:119097-119348 [Mycobacterium tuberculosis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References