Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 92733..93421 | Replicon | chromosome |
| Accession | NZ_OW052302 | ||
| Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P0A653 |
| Locus tag | MR176_RS00415 | Protein ID | WP_003409958.1 |
| Coordinates | 93002..93421 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ28 |
| Locus tag | MR176_RS00410 | Protein ID | WP_003409968.1 |
| Coordinates | 92733..92993 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MR176_RS00385 | 88224..88823 | - | 600 | WP_003409989.1 | L-lysine exporter | - |
| MR176_RS00390 | 88932..89843 | + | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
| MR176_RS00395 | 89928..90158 | - | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
| MR176_RS00400 | 90273..90926 | + | 654 | WP_003409976.1 | cutinase Cfp21 | - |
| MR176_RS00405 | 90914..92590 | - | 1677 | WP_003899118.1 | PecA family PE domain-processing aspartic protease | - |
| MR176_RS00410 | 92733..92993 | + | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MR176_RS00415 | 93002..93421 | + | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MR176_RS00420 | 93646..94614 | + | 969 | WP_003899116.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| MR176_RS00425 | 94805..95491 | + | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
| MR176_RS00430 | 95670..97115 | + | 1446 | WP_003899115.1 | APC family permease | - |
| MR176_RS00435 | 97078..97918 | - | 841 | Protein_86 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T295205 WP_003409958.1 NZ_OW052302:93002-93421 [Mycobacterium tuberculosis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C4H9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C483 |