Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mbcAT/RES-TIGR02293 |
Location | 85197..86095 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mbcT | Uniprot ID | P64908 |
Locus tag | MR176_RS00370 | Protein ID | WP_003410001.1 |
Coordinates | 85535..86095 (+) | Length | 187 a.a. |
Antitoxin (Protein)
Gene name | mbcA | Uniprot ID | P64910 |
Locus tag | MR176_RS00365 | Protein ID | WP_003410003.1 |
Coordinates | 85197..85538 (+) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS00330 | 80913..81269 | + | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
MR176_RS00335 | 81322..81594 | + | 273 | WP_003410017.1 | DUF1490 family protein | - |
MR176_RS00340 | 81591..83843 | + | 2253 | WP_016719189.1 | cation transporter ATPase CptG | - |
MR176_RS00345 | 83943..84191 | + | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | - |
MR176_RS00350 | 84185..84529 | + | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | - |
MR176_RS00355 | 84618..84953 | + | 336 | WP_003410009.1 | dehydrogenase | - |
MR176_RS00360 | 84854..85111 | - | 258 | WP_003410006.1 | hypothetical protein | - |
MR176_RS00365 | 85197..85538 | + | 342 | WP_003410003.1 | DUF2384 domain-containing protein | Antitoxin |
MR176_RS00370 | 85535..86095 | + | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | Toxin |
MR176_RS00375 | 86615..87154 | - | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
MR176_RS00380 | 87380..87808 | - | 429 | WP_003409992.1 | cellulose-binding protein | - |
MR176_RS00385 | 88224..88823 | - | 600 | WP_003409989.1 | L-lysine exporter | - |
MR176_RS00390 | 88932..89843 | + | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
MR176_RS00395 | 89928..90158 | - | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
MR176_RS00400 | 90273..90926 | + | 654 | WP_003409976.1 | cutinase Cfp21 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 187 a.a. Molecular weight: 20248.70 Da Isoelectric Point: 4.5091
>T295204 WP_003410001.1 NZ_OW052302:85535-86095 [Mycobacterium tuberculosis]
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
Download Length: 561 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|