Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 83943..84529 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLY3 |
Locus tag | MR176_RS00350 | Protein ID | WP_003410010.1 |
Coordinates | 84185..84529 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL58 |
Locus tag | MR176_RS00345 | Protein ID | WP_003410014.1 |
Coordinates | 83943..84191 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS00325 | 79989..80756 | - | 768 | WP_003410019.1 | hemerythrin domain-containing protein | - |
MR176_RS00330 | 80913..81269 | + | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
MR176_RS00335 | 81322..81594 | + | 273 | WP_003410017.1 | DUF1490 family protein | - |
MR176_RS00340 | 81591..83843 | + | 2253 | WP_016719189.1 | cation transporter ATPase CptG | - |
MR176_RS00345 | 83943..84191 | + | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MR176_RS00350 | 84185..84529 | + | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | Toxin |
MR176_RS00355 | 84618..84953 | + | 336 | WP_003410009.1 | dehydrogenase | - |
MR176_RS00360 | 84854..85111 | - | 258 | WP_003410006.1 | hypothetical protein | - |
MR176_RS00365 | 85197..85538 | + | 342 | WP_003410003.1 | DUF2384 domain-containing protein | - |
MR176_RS00370 | 85535..86095 | + | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | - |
MR176_RS00375 | 86615..87154 | - | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
MR176_RS00380 | 87380..87808 | - | 429 | WP_003409992.1 | cellulose-binding protein | - |
MR176_RS00385 | 88224..88823 | - | 600 | WP_003409989.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12230.12 Da Isoelectric Point: 9.8887
>T295203 WP_003410010.1 NZ_OW052302:84185-84529 [Mycobacterium tuberculosis]
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
VVISRAEIYWADLGPPSGSQPAKRRPVLVIQSDPYNASRLATVIAAVITSNTALAAMPGNVFLPATTTRLPRDSVVNVTA
IVTLNKTDLTDRVGEVPASLMHEVDRGLRRVLDL
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5HK3 | |
PDB | 5HK0 | |
PDB | 5HKC |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FAW9 |