Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 60226..60852 | Replicon | chromosome |
Accession | NZ_OW052302 | ||
Organism | Mycobacterium tuberculosis strain Lineage 3.1.1 isolate Mycobacterium tuberculosis |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P64926 |
Locus tag | MR176_RS00245 | Protein ID | WP_003410075.1 |
Coordinates | 60226..60624 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A806JLL8 |
Locus tag | MR176_RS00250 | Protein ID | WP_003911750.1 |
Coordinates | 60625..60852 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MR176_RS00215 | 55825..57081 | + | 1257 | WP_016720149.1 | HNH endonuclease signature motif containing protein | - |
MR176_RS00220 | 57209..57799 | - | 591 | WP_003899131.1 | IS110 family transposase | - |
MR176_RS00225 | 57753..58373 | - | 621 | WP_003410086.1 | IS110 family transposase | - |
MR176_RS00230 | 58461..58640 | + | 180 | Protein_45 | hypothetical protein | - |
MR176_RS00235 | 59077..59511 | - | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
MR176_RS00240 | 59612..60043 | + | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
MR176_RS00245 | 60226..60624 | - | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
MR176_RS00250 | 60625..60852 | - | 228 | WP_003911750.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
MR176_RS00255 | 61111..62280 | + | 1170 | WP_003899126.1 | ATP-binding protein | - |
MR176_RS00260 | 62469..62813 | + | 345 | WP_003410065.1 | ferredoxin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T295202 WP_003410075.1 NZ_OW052302:c60624-60226 [Mycobacterium tuberculosis]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|