Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 4246928..4247457 Replicon chromosome
Accession NZ_OW052189
Organism Mycobacterium tuberculosis strain Lineage 2.2.7 isolate Mycobacterium tuberculosis

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag MR259_RS19865 Protein ID WP_003411124.1
Coordinates 4246928..4247245 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag MR259_RS19870 Protein ID WP_003411127.1
Coordinates 4247242..4247457 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MR259_RS19835 4241949..4243025 + 1077 WP_003411110.1 hypothetical protein -
MR259_RS19840 4243022..4243303 + 282 WP_003411112.1 DUF5703 family protein -
MR259_RS19845 4243339..4244412 + 1074 WP_003901338.1 quinone-dependent dihydroorotate dehydrogenase -
MR259_RS19850 4244417..4244947 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
MR259_RS19855 4244995..4246341 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
MR259_RS19865 4246928..4247245 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MR259_RS19870 4247242..4247457 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
MR259_RS19875 4247712..4248770 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
MR259_RS19880 4248900..4249256 - 357 WP_003411130.1 hypothetical protein -
MR259_RS19885 4249351..4250133 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
MR259_RS19890 4250401..4250691 - 291 WP_003900476.1 YggT family protein -
MR259_RS19895 4250853..4251509 - 657 WP_003411133.1 cell division protein SepF -
MR259_RS19900 4251571..4252350 - 780 WP_015575160.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T295200 WP_003411124.1 NZ_OW052189:c4247245-4246928 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT295200 WP_003411127.1 NZ_OW052189:c4247457-4247242 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References